PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013584318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 281aa    MW: 32024.6 Da    PI: 5.3869
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013584318.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171561248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
   XP_013584318.1 15 GPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 61
                     89*****************************99************97 PP

2Myb_DNA-binding29.91.3e-0967108147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt+    ++w+++
   XP_013584318.1  67 RGNFTPHEEGMIIHLQALLGNK-WASIASYLP-QRTD---NNYWNTH 108
                      89********************.*********.****...5666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-23564IPR009057Homeodomain-like
PROSITE profilePS5129423.25965IPR017930Myb domain
SuperFamilySSF466896.36E-2711106IPR009057Homeodomain-like
SMARTSM007171.4E-131363IPR001005SANT/Myb domain
PfamPF002495.8E-161561IPR001005SANT/Myb domain
CDDcd001675.65E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.0E-1865114IPR009057Homeodomain-like
PROSITE profilePS5129413.54866113IPR017930Myb domain
SMARTSM007172.1E-666111IPR001005SANT/Myb domain
PfamPF002495.6E-867108IPR001005SANT/Myb domain
CDDcd001671.99E-569109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009416Biological Processresponse to light stimulus
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010118Biological Processstomatal movement
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MGRPPCCEKI GIKEGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLLRCS KSCRLRWTNY  60
LRPRIKRGNF TPHEEGMIIH LQALLGNKWA SIASYLPQRT DNNYWNTHLK KNLNKSESEE  120
RSISENMALQ TSATRNTINH RSTTYASSTE NISRLLEGSM RASPKSSTAN FLEEKMQKGT  180
TNLIDDHENQ FPCEHVQGSW EEDQSKTING DDDHGFLVHP KESEKNVSCD HDVQEDGDGV  240
DDDHKNATPP LTFIEKWLLE ETSTGVQMEE MSHLMELSNM L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-201211325128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00132DAPTransfer from AT1G08810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1174691e-175AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21.
GenBankAY5195511e-175AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds.
GenBankBT0050741e-175BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013710000.10.0PREDICTED: myb-related protein 306-like
RefseqXP_013584318.10.0PREDICTED: myb-related protein 306
SwissprotP813923e-77MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0D3C8L10.0A0A0D3C8L1_BRAOL; Uncharacterized protein
STRINGBra018598.1-P1e-169(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-155myb domain protein 60